PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof001340
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family MYB_related
Protein Properties Length: 565aa    MW: 63453 Da    PI: 7.555
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-1075133734PU_refplantGDBView CDS
gnl|UG|Sof#S17233865PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.87.8e-11111151445
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      W ++E+ ll+++++++G g+W  +a+++g +++  qc++++ 
        Sof001340 111 WNADEEILLLEGIEMYGLGNWLEVAEHVG-TKSKLQCIDHYT 151
                      *****************************.**********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0250244.1E-17438561IPR016827Transcriptional adaptor 2
SMARTSM002911.6E-104792IPR000433Zinc finger, ZZ-type
PfamPF005693.2E-94990IPR000433Zinc finger, ZZ-type
CDDcd023352.49E-265199No hitNo description
PROSITE profilePS5013510.8245194IPR000433Zinc finger, ZZ-type
SuperFamilySSF578502.71E-1451114No hitNo description
PROSITE patternPS0135705380IPR000433Zinc finger, ZZ-type
SuperFamilySSF466893.59E-12104157IPR009057Homeodomain-like
PROSITE profilePS5129321.633106158IPR017884SANT domain
SMARTSM007175.0E-10107156IPR001005SANT/Myb domain
PfamPF002498.6E-11110151IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-7111153IPR009057Homeodomain-like
CDDcd001671.06E-10111152No hitNo description
SuperFamilySSF466898.78E-21469554IPR009057Homeodomain-like
PROSITE profilePS509349.524474565IPR007526SWIRM domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0016573Biological Processhistone acetylation
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 565 aa     Download sequence    Send to blast
MGRSRGVPNS GDDDTGHRSK RRRVSSGGDA TDSISAAIGG AGEGGGKKAL YHCNYCNKDI  60
SGKIRIKCSK CPDFDLCVEC FSVGAEVTPH RSNHPYRVMD NLSFPLICPD WNADEEILLL  120
EGIEMYGLGN WLEVAEHVGT KSKLQCIDHY TTAYMNSPCY PLPDMSHVNG KNRKELLAMA  180
KVQGETKKGT SLLPGELTPK AESPFSPSRV KMEDALGEGL ASRSPSHIAV GANKKASNVG  240
QIKDGANVSK VEDGHVDRSV GVKKPRYSAD EGPSLTELSG YNAKRHEFDP EYDNDAEQAL  300
AEMEFKETDS ETDRELKLRV LHIYLSRLEE RKRRKEFILE RNLLFPNPLE KDLTNEDREV  360
YHRYKVFMRF LSKEEHEALI RSVIEERKIR RRIQELQECR SAGCRTLAEA KIHIEQKRKK  420
EYELNAQKAK ESSHLIANNK LVQKMNRPMK IESDGNLDPK KGGAGLDSPK TTGLTSVKQW  480
DDWDIVGLPG AELLSASEKL LCCQNRLLPS HYLRMQEVLM QEIFKGSVLK KEDAHVLFKV  540
DPTKVDSVYD MVTKKLGNHE EAPTV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11923KRRRV
2330335RKRRKE
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.8460.0bud| callus| crown| inflorescence| leaf| root| seed| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002463870.10.0hypothetical protein SORBIDRAFT_01g007950
SwissprotQ75LL60.0TADA2_ORYSJ; Transcriptional adapter ADA2
TrEMBLC5X0B40.0C5X0B4_SORBI; Putative uncharacterized protein Sb01g007950
STRINGSb01g007950.10.0(Sorghum bicolor)